| Class b: All beta proteins [48724] (178 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
| Protein automated matches [226913] (9 species) not a true protein |
| Species Clostridium botulinum [TaxId:498213] [257331] (1 PDB entry) |
| Domain d4ouja1: 4ouj A:11-153 [257332] automated match to d4lo0a1 complexed with lbt |
PDB Entry: 4ouj (more details), 1.46 Å
SCOPe Domain Sequences for d4ouja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ouja1 b.42.2.0 (A:11-153) automated matches {Clostridium botulinum [TaxId: 498213]}
lndkivtisckantdlffyqvpgngnvslfqqtrnylerwriiydsnkaaykiksmniyn
tnlvltwnapthnisaqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnssyikfiiedyvisdfk
Timeline for d4ouja1: