SCOPe 2.08: Domain d4oujb1: 4ouj B:11-153

Lineage for d4oujb1 (4ouj B:11-153)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:498213] [257331] (1 PDB entry)

8. Domain d4oujb1: 4ouj B:11-153 [263346]
   automated match to d4lo0a1

Details for d4oujb1

PDB Entry: 4ouj, 1.46 Å

PDB Description: crystal structure of ha33b-lac

PDB Compounds: (B:) Hemagglutinin component HA33

SCOPe Domain Sequences for d4oujb1:

Sequence; same for both SEQRES and ATOM records:

>d4oujb1 b.42.2.0 (B:11-153) automated matches {Clostridium botulinum [TaxId: 498213]}
lndkivtisckantdlffyqvpgngnvslfqqtrnylerwriiydsnkaaykiksmniyn
tnlvltwnapthnisaqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnssyikfiiedyvisdfk

Timeline for d4oujb1:

• d4oujb1 first appeared in SCOPe 2.05
  
• d4oujb1 appears in SCOPe 2.07