Lineage for d1elt__ (1elt -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Elastase [50536] (3 species) 
Species Salmon (Salmo salar) [TaxId:8030] [50539] (1 PDB entry) 
Domain d1elt__: 1elt - [26281]
Details for d1elt__
PDB Entry: 1elt (more details), 1.61 Å
PDB Description: structure of native pancreatic elastase from north atlantic salmon at 1.61 angstroms resolution
SCOP Domain Sequences for d1elt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elt__ b.47.1.2 (-) Elastase {Salmon (Salmo salar)}
vvggrvaqpnswpwqislqyksgssyyhtcggslirqgwvmtaahcvdsartwrvvlgeh
nlntnegkeqimtvnsvfihsgwnsddvaggydiallrlntqaslnsavqlaalppsnqi
lpnnnpcyitgwgktstggplsdslkqawlpsvdhatcsssgwwgstvkttmvcagggan
sgcngdsggplncqvngsyyvhgvtsfvsssgcnaskkptvftrvsayiswmngim
SCOP Domain Coordinates for d1elt__:
Click to download the PDB-style file with coordinates for d1elt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1elt__:
- d1elt__ appears in SCOP 1.57
- d1elt__ appears in the current release, SCOPe 2.08, called d1elta_
View in 3D