Lineage for d1elta_ (1elt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056282Protein Elastase [50536] (4 species)
  7. 2056283Species Atlantic salmon (Salmo salar) [TaxId:8030] [50539] (1 PDB entry)
  8. 2056284Domain d1elta_: 1elt A: [26281]
    complexed with ca

Details for d1elta_

PDB Entry: 1elt (more details), 1.61 Å

PDB Description: structure of native pancreatic elastase from north atlantic salmon at 1.61 angstroms resolution
PDB Compounds: (A:) elastase

SCOPe Domain Sequences for d1elta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elta_ b.47.1.2 (A:) Elastase {Atlantic salmon (Salmo salar) [TaxId: 8030]}
vvggrvaqpnswpwqislqyksgssyyhtcggslirqgwvmtaahcvdsartwrvvlgeh
nlntnegkeqimtvnsvfihsgwnsddvaggydiallrlntqaslnsavqlaalppsnqi
lpnnnpcyitgwgktstggplsdslkqawlpsvdhatcsssgwwgstvkttmvcagggan
sgcngdsggplncqvngsyyvhgvtsfvsssgcnaskkptvftrvsayiswmngim

SCOPe Domain Coordinates for d1elta_:

Click to download the PDB-style file with coordinates for d1elta_.
(The format of our PDB-style files is described here.)

Timeline for d1elta_: