![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:195102] [267954] (2 PDB entries) |
![]() | Domain d4jkmb1: 4jkm B:1-182 [262760] Other proteins in same PDB: d4jkma2, d4jkma3, d4jkma4, d4jkmb2, d4jkmb3, d4jkmb4, d4jkmd1, d4jkmd2 automated match to d3hn3a1 |
PDB Entry: 4jkm (more details), 2.26 Å
SCOPe Domain Sequences for d4jkmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkmb1 b.18.1.0 (B:1-182) automated matches {Clostridium perfringens [TaxId: 195102]} mlypiitesrqlidlsgiwkfklnegnglteelskapledtiemavpssyndlvesqevr dhvgwvwyernftipktllnerivlrfgsatheakvylngellvehkggftpfeaeindl lvsgdnrltvavnniidettlpvglvkevevdgkkviknsvnfdffnyagihrpvkiytt pk
Timeline for d4jkmb1: