![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:195102] [267955] (2 PDB entries) |
![]() | Domain d4jkmb2: 4jkm B:183-275 [262761] Other proteins in same PDB: d4jkma1, d4jkma3, d4jkma4, d4jkmb1, d4jkmb3, d4jkmb4, d4jkmd1, d4jkmd2 automated match to d3hn3a2 |
PDB Entry: 4jkm (more details), 2.26 Å
SCOPe Domain Sequences for d4jkmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkmb2 b.1.4.0 (B:183-275) automated matches {Clostridium perfringens [TaxId: 195102]} syieditivtdfkenngyvnyevqavgkcnikvtiideennivaegegkegkltinnvhl wepmnaylyklkvellddeeiidtyfeefgvrt
Timeline for d4jkmb2: