Lineage for d4jkma3 (4jkm A:276-599)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083807Species Clostridium perfringens [TaxId:195102] [267956] (1 PDB entry)
  8. 2083808Domain d4jkma3: 4jkm A:276-599 [262759]
    Other proteins in same PDB: d4jkma1, d4jkma2, d4jkma4, d4jkmb1, d4jkmb2, d4jkmb4, d4jkmd1, d4jkmd2
    automated match to d3hn3a3

Details for d4jkma3

PDB Entry: 4jkm (more details), 2.26 Å

PDB Description: crystal structure of clostridium perfringens beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkma3 c.1.8.0 (A:276-599) automated matches {Clostridium perfringens [TaxId: 195102]}
vevkdgkflinnkpfyfkgfgkhedsyvngrgineainikdfnlmkwigansfrtshypy
seeimrladregivvidetpavglhlnfmatgfggdapkrdtwkeigtkeaherilrelv
srdknhpcvvmwsvanepdsdsegakeyfeplikltkeldpqkrpvtvvtylmstpdrck
vgdivdvlclnryygwyvaggdleeakrmledelkgweercpktpimfteygadtvaglh
dtvpvmfteeyqveyykanhevmdkcknfvgeqvwnfadfatsqgiirvqgnkkgiftre
rkpkmiahslrerwtnipefgykk

SCOPe Domain Coordinates for d4jkma3:

Click to download the PDB-style file with coordinates for d4jkma3.
(The format of our PDB-style files is described here.)

Timeline for d4jkma3: