Lineage for d4jkma1 (4jkm A:1-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775068Species Clostridium perfringens [TaxId:195102] [267954] (2 PDB entries)
  8. 2775069Domain d4jkma1: 4jkm A:1-182 [262757]
    Other proteins in same PDB: d4jkma2, d4jkma3, d4jkma4, d4jkmb2, d4jkmb3, d4jkmb4, d4jkmd1, d4jkmd2
    automated match to d3hn3a1

Details for d4jkma1

PDB Entry: 4jkm (more details), 2.26 Å

PDB Description: crystal structure of clostridium perfringens beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkma1 b.18.1.0 (A:1-182) automated matches {Clostridium perfringens [TaxId: 195102]}
mlypiitesrqlidlsgiwkfklnegnglteelskapledtiemavpssyndlvesqevr
dhvgwvwyernftipktllnerivlrfgsatheakvylngellvehkggftpfeaeindl
lvsgdnrltvavnniidettlpvglvkevevdgkkviknsvnfdffnyagihrpvkiytt
pk

SCOPe Domain Coordinates for d4jkma1:

Click to download the PDB-style file with coordinates for d4jkma1.
(The format of our PDB-style files is described here.)

Timeline for d4jkma1: