Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein automated matches [190264] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [229208] (7 PDB entries) |
Domain d4bpvd_: 4bpv D: [262535] automated match to d4bs5a_ complexed with ofh |
PDB Entry: 4bpv (more details), 2 Å
SCOPe Domain Sequences for d4bpvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bpvd_ d.3.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tlpdtvdwrekgcvtevkyqgscgacwafsavgalegqlklktgklislsaqnlvdcsne ekygnkgcgggymteafqyiidnggieadasypykamdekchynsknraatcsryiqlpf gdedalkeavatkgpvsvgidashssfffyksgvyddpsctgnvnhgvlvvgygtldgkd ywlvknswglnfgdqgyirmarnnknhcgiasycsypei
Timeline for d4bpvd_: