Lineage for d4bpvd_ (4bpv D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1888976Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1889314Protein automated matches [190264] (9 species)
    not a true protein
  7. 1889356Species Mouse (Mus musculus) [TaxId:10090] [229208] (7 PDB entries)
  8. 1889382Domain d4bpvd_: 4bpv D: [262535]
    automated match to d4bs5a_
    complexed with ofh

Details for d4bpvd_

PDB Entry: 4bpv (more details), 2 Å

PDB Description: mouse cathepsin s with covalent ligand
PDB Compounds: (D:) cathepsin S

SCOPe Domain Sequences for d4bpvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bpvd_ d.3.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlpdtvdwrekgcvtevkyqgscgacwafsavgalegqlklktgklislsaqnlvdcsne
ekygnkgcgggymteafqyiidnggieadasypykamdekchynsknraatcsryiqlpf
gdedalkeavatkgpvsvgidashssfffyksgvyddpsctgnvnhgvlvvgygtldgkd
ywlvknswglnfgdqgyirmarnnknhcgiasycsypei

SCOPe Domain Coordinates for d4bpvd_:

Click to download the PDB-style file with coordinates for d4bpvd_.
(The format of our PDB-style files is described here.)

Timeline for d4bpvd_: