SCOPe 2.08: Domain d3wp3b_: 3wp3 B:

Lineage for d3wp3b_ (3wp3 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Penicillium funiculosum [TaxId:28572] [110142] (2 PDB entries)
   Uniprot Q9HFH0

8. Domain d3wp3b_: 3wp3 B: [262442]
   automated match to d3wp3a_

Details for d3wp3b_

PDB Entry: 3wp3, 1.98 Å

PDB Description: xylanase 11c from talaromyces cellulolyticus (formerly known as acremonium cellulolyticus)

PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3wp3b_:

Sequence; same for both SEQRES and ATOM records:

>d3wp3b_ b.29.1.11 (B:) Xylanase II {Penicillium funiculosum [TaxId: 28572]}
qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvncgdftsgkgwnpanaqtv
tysgefntsgnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiyst
qrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
ssgsstitvs

Timeline for d3wp3b_:

• d3wp3b_ first appeared in SCOPe 2.05
  
• d3wp3b_ appears in SCOPe 2.07