Lineage for d3wp3a_ (3wp3 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) 
Protein Xylanase II [49979] (21 species)
Partial overlap with common fold and the active sites of the other endoglucanases
Species Penicillium funiculosum [TaxId:28572] [110142] (2 PDB entries)
Uniprot Q9HFH0
Domain d3wp3a_: 3wp3 A: [261311]
automated match to d1te1b_
Details for d3wp3a_
PDB Entry: 3wp3 (more details), 1.98 Å
PDB Description: xylanase 11c from talaromyces cellulolyticus (formerly known as acremonium cellulolyticus)
PDB Compounds: (A:) endo-1,4-beta-xylanaseSCOPe Domain Sequences for d3wp3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wp3a_ b.29.1.11 (A:) Xylanase II {Penicillium funiculosum [TaxId: 28572]}
qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvncgdftsgkgwnpanaqtv
tysgefntsgnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiyst
qrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
ssgsstitvs
SCOPe Domain Coordinates for d3wp3a_:
Click to download the PDB-style file with coordinates for d3wp3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wp3a_:
- d3wp3a_ first appeared in SCOPe 2.04
- d3wp3a_ appears in SCOPe 2.07
View in 3D
