![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein Xylanase II [49979] (19 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Penicillium funiculosum [TaxId:28572] [110142] (2 PDB entries) Uniprot Q9HFH0 |
![]() | Domain d3wp3b_: 3wp3 B: [262442] automated match to d3wp3a_ |
PDB Entry: 3wp3 (more details), 1.98 Å
SCOPe Domain Sequences for d3wp3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wp3b_ b.29.1.11 (B:) Xylanase II {Penicillium funiculosum [TaxId: 28572]} qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvncgdftsgkgwnpanaqtv tysgefntsgnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiyst qrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye ssgsstitvs
Timeline for d3wp3b_: