SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wp3a_ (3wp3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043667Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2043712Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2043796Species Penicillium funiculosum [TaxId:28572] [110142] (2 PDB entries)
    Uniprot Q9HFH0
  8. 2043797Domain d3wp3a_: 3wp3 A: [261311]
    automated match to d1te1b_

Details for d3wp3a_

PDB Entry: 3wp3 (more details), 1.98 Å

PDB Description: Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus)
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3wp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wp3a_ b.29.1.11 (A:) Xylanase II {Penicillium funiculosum [TaxId: 28572]}
qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvncgdftsgkgwnpanaqtv
tysgefntsgnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiyst
qrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
ssgsstitvs

SCOPe Domain Coordinates for d3wp3a_:

Click to download the PDB-style file with coordinates for d3wp3a_.
(The format of our PDB-style files is described here.)

Timeline for d3wp3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3wp3b_