SCOPe 2.08: Domain d4cinb1: 4cin B:83-197

Lineage for d4cinb1 (4cin B:83-197)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)

8. Domain d4cinb1: 4cin B:83-197 [260883]
   Other proteins in same PDB: d4cina2, d4cinb2
   automated match to d1ysga_
   complexed with ca, edo, epe

Details for d4cinb1

PDB Entry: 4cin, 2.69 Å

PDB Description: Complex of Bcl-xL with its BH3 domain

PDB Compounds: (B:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4cinb1:

Sequence, based on SEQRES records:

>d4cinb1 f.1.4.1 (B:83-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgriva
ffsfggalcvesvdkemqvlvsriaawmatylndhlepwiqenggwdtfvelygn

Sequence, based on observed residues (ATOM records):

>d4cinb1 f.1.4.1 (B:83-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maavkqalreagdefelryrrafhitpgtayqsfeqvvnelfrdgvnwgrivaffsfgga
lcvesvdkemqvlvsriaawmatylndhlepwiqenggwdtfvelygn

Timeline for d4cinb1:

• d4cinb1 first appeared in SCOPe 2.04, called d4cinb_
  
• d4cinb1 was called d4cinb_ in SCOPe 2.07