SCOPe 2.08: Domain d4cina1: 4cin A:21-197

Lineage for d4cina1 (4cin A:21-197)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)

8. Domain d4cina1: 4cin A:21-197 [260882]
   Other proteins in same PDB: d4cina2, d4cinb2
   automated match to d1ysga_
   complexed with ca, edo, epe

Details for d4cina1

PDB Entry: 4cin, 2.69 Å

PDB Description: Complex of Bcl-xL with its BH3 domain

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4cina1:

Sequence; same for both SEQRES and ATOM records:

>d4cina1 f.1.4.1 (A:21-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyswsqmaavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvn
wgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlepwiqenggwdtfvelyg
n

Timeline for d4cina1:

• d4cina1 first appeared in SCOPe 2.04, called d4cina_
  
• d4cina1 was called d4cina_ in SCOPe 2.07