Lineage for d4kv5b_ (4kv5 B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638479Protein TGF-beta1 [57512] (1 species)
  7. 2638480Species Human (Homo sapiens) [TaxId:9606] [57513] (6 PDB entries)
  8. 2638486Domain d4kv5b_: 4kv5 B: [259778]
    Other proteins in same PDB: d4kv5e_, d4kv5f1, d4kv5f2, d4kv5g_, d4kv5h_, d4kv5i1, d4kv5i2, d4kv5j_, d4kv5k1, d4kv5k2, d4kv5l1, d4kv5l2
    automated match to d1klca_

Details for d4kv5b_

PDB Entry: 4kv5 (more details), 3 Å

PDB Description: scfv gc1009 in complex with tgf-beta1.
PDB Compounds: (B:) Transforming growth factor beta-1

SCOPe Domain Sequences for d4kv5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kv5b_ g.17.1.2 (B:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

SCOPe Domain Coordinates for d4kv5b_:

Click to download the PDB-style file with coordinates for d4kv5b_.
(The format of our PDB-style files is described here.)

Timeline for d4kv5b_: