Class g: Small proteins [56992] (98 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein TGF-beta1 [57512] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57513] (6 PDB entries) |
Domain d4kv5d_: 4kv5 D: [262877] Other proteins in same PDB: d4kv5e_, d4kv5f1, d4kv5f2, d4kv5g_, d4kv5h_, d4kv5i1, d4kv5i2, d4kv5j_, d4kv5k1, d4kv5k2, d4kv5l1, d4kv5l2 automated match to d3kfda_ |
PDB Entry: 4kv5 (more details), 3 Å
SCOPe Domain Sequences for d4kv5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kv5d_ g.17.1.2 (D:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]} aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
Timeline for d4kv5d_: