Lineage for d1klca_ (1klc A:)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
disulfide-rich fold; common core is all-betaSuperfamily g.17.1: Cystine-knot cytokines [57501] (8 families) 
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) 
Protein TGF-beta1 [57512] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57513] (6 PDB entries) 
Domain d1klca_: 1klc A: [44783]
Details for d1klca_
PDB Entry: 1klc (more details)
PDB Description: solution structure of tgf-b1, nmr, minimized average structure
PDB Compounds: (A:) transforming growth factor-beta 1SCOPe Domain Sequences for d1klca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klca_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
SCOPe Domain Coordinates for d1klca_:
Click to download the PDB-style file with coordinates for d1klca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1klca_:
View in 3D
