SCOPe 2.06: Domain d1klca_: 1klc A:

Lineage for d1klca_ (1klc A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein TGF-beta1 [57512] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57513] (5 PDB entries)

8. Domain d1klca_: 1klc A: [44783]

Details for d1klca_

PDB Entry: 1klc

PDB Description: solution structure of tgf-b1, nmr, minimized average structure

PDB Compounds: (A:) transforming growth factor-beta 1

SCOPe Domain Sequences for d1klca_:

Sequence; same for both SEQRES and ATOM records:

>d1klca_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

Timeline for d1klca_:

• d1klca_ first appeared (with stable ids) in SCOP 1.55
  
• d1klca_ appears in SCOPe 2.05
  
• d1klca_ appears in SCOPe 2.07
  
• d1klca_ appears in the current release, SCOPe 2.08