Lineage for d1klca_ (1klc A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins) 
Protein TGF-beta1 [57512] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57513] (3 PDB entries) 
Domain d1klca_: 1klc A: [44783]
Details for d1klca_
PDB Entry: 1klc (more details)
PDB Description: solution structure of tgf-b1, nmr, minimized average structure
SCOP Domain Sequences for d1klca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klca_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens)}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
SCOP Domain Coordinates for d1klca_:
Click to download the PDB-style file with coordinates for d1klca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1klca_:
- d1klca_ appears in SCOP 1.57
- d1klca_ appears in the current release, SCOPe 2.08
View in 3D
