Lineage for d4d02a2 (4d02 A:250-400)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587788Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1587789Protein automated matches [190158] (17 species)
    not a true protein
  7. 1587836Species Escherichia coli [TaxId:83333] [259351] (1 PDB entry)
  8. 1587837Domain d4d02a2: 4d02 A:250-400 [259352]
    Other proteins in same PDB: d4d02a1
    automated match to d1ycga1
    complexed with cl, fe, fmn, gol, o, po4

Details for d4d02a2

PDB Entry: 4d02 (more details), 1.76 Å

PDB Description: the crystallographic structure of flavorubredoxin from escherichia coli
PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d4d02a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d02a2 c.23.5.0 (A:250-400) automated matches {Escherichia coli [TaxId: 83333]}
qedritifydtmsnntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl
vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl
slkakwrpdqdalklcrehgreiarqwalap

SCOPe Domain Coordinates for d4d02a2:

Click to download the PDB-style file with coordinates for d4d02a2.
(The format of our PDB-style files is described here.)

Timeline for d4d02a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d02a1