Lineage for d4d02a1 (4d02 A:2-249)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679746Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1679747Protein automated matches [190418] (12 species)
    not a true protein
  7. 1679755Species Escherichia coli [TaxId:83333] [259349] (1 PDB entry)
  8. 1679756Domain d4d02a1: 4d02 A:2-249 [259350]
    Other proteins in same PDB: d4d02a2
    automated match to d1ycga2
    complexed with cl, fe, fmn, gol, o, po4

Details for d4d02a1

PDB Entry: 4d02 (more details), 1.76 Å

PDB Description: the crystallographic structure of flavorubredoxin from escherichia coli
PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d4d02a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d02a1 d.157.1.0 (A:2-249) automated matches {Escherichia coli [TaxId: 83333]}
sivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvq
nlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnf
nvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnde
vdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqivel
ylkwaady

SCOPe Domain Coordinates for d4d02a1:

Click to download the PDB-style file with coordinates for d4d02a1.
(The format of our PDB-style files is described here.)

Timeline for d4d02a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d02a2