PDB entry 4d02

View 4d02 on RCSB PDB site
Description: The crystallographic structure of Flavorubredoxin from Escherichia coli
Class: electron transport
Keywords: electron transport, fdp, nitric oxide, roo, rubredoxin, flrd
Deposited on 2014-04-23, released 2014-09-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.1407
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anaerobic nitric oxide reductase flavorubredoxin
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4d02a1, d4d02a2
  • Heterogens: FMN, FE, O, PO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d02A (A:)
    msivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefv
    qnlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewn
    fnvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnd
    evdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqive
    lylkwaadyqedritifydtmsnntrmmadaiaqgiaetdprvavkifnvarsdkneilt
    nvfrskgvlvgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrl
    qdagfemslslkakwrpdqdalklcrehgreiarqwalaplpqstvntvvkeetsattta
    dlgprmqcsvcqwiydpakgepmqdvapgtpwsevpdnflcpecslgkdvfeelaseak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d02A (A:)
    sivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvq
    nlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnf
    nvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnde
    vdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqivel
    ylkwaadyqedritifydtmsnntrmmadaiaqgiaetdprvavkifnvarsdkneiltn
    vfrskgvlvgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlq
    dagfemslslkakwrpdqdalklcrehgreiarqwalap