| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (31 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [259351] (5 PDB entries) |
| Domain d4d02a2: 4d02 A:250-400 [259352] Other proteins in same PDB: d4d02a1 automated match to d1ycga1 complexed with cl, fe, fmn, gol, o, po4 |
PDB Entry: 4d02 (more details), 1.76 Å
SCOPe Domain Sequences for d4d02a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d02a2 c.23.5.0 (A:250-400) automated matches {Escherichia coli [TaxId: 83333]}
qedritifydtmsnntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl
vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl
slkakwrpdqdalklcrehgreiarqwalap
Timeline for d4d02a2: