Class b: All beta proteins [48724] (178 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
Protein alpha-Subunit of urease [51340] (4 species) |
Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries) |
Domain d4cexc1: 4cex C:1-131,C:435-483 [259183] Other proteins in same PDB: d4cexa_, d4cexb_, d4cexc2 automated match to d4ubpc1 complexed with edo, f, ni, so4 |
PDB Entry: 4cex (more details), 1.59 Å
SCOPe Domain Sequences for d4cexc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cexc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]} mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt v
Timeline for d4cexc1: