SCOPe 2.07: Domain d4cexb_: 4cex B:

Lineage for d4cexb_ (4cex B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (2 families)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries)

8. Domain d4cexb_: 4cex B: [259181]
   Other proteins in same PDB: d4cexa_, d4cexc1, d4cexc2
   automated match to d4ubpb_
   complexed with edo, f, ni, so4

Details for d4cexb_

PDB Entry: 4cex, 1.59 Å

PDB Description: 1.59 a resolution fluoride inhibited sporosarcina pasteurii urease

PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4cexb_:

Sequence; same for both SEQRES and ATOM records:

>d4cexb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d4cexb_:

• d4cexb_ first appeared in SCOPe 2.04
  
• d4cexb_ appears in SCOPe 2.06
  
• d4cexb_ appears in the current release, SCOPe 2.08