SCOPe 2.07: Domain d4cexa_: 4cex A:

Lineage for d4cexa_ (4cex A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries)

8. Domain d4cexa_: 4cex A: [259177]
   Other proteins in same PDB: d4cexb_, d4cexc1, d4cexc2
   automated match to d4ubpa_
   complexed with edo, f, ni, so4

Details for d4cexa_

PDB Entry: 4cex, 1.59 Å

PDB Description: 1.59 a resolution fluoride inhibited sporosarcina pasteurii urease

PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d4cexa_:

Sequence; same for both SEQRES and ATOM records:

>d4cexa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d4cexa_:

• d4cexa_ first appeared in SCOPe 2.04
  
• d4cexa_ appears in SCOPe 2.06
  
• d4cexa_ appears in the current release, SCOPe 2.08