Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) |
Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins) automatically mapped to Pfam PF00547 |
Protein Urease, gamma-subunit [54113] (4 species) |
Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries) |
Domain d4cexa_: 4cex A: [259177] Other proteins in same PDB: d4cexb_, d4cexc1, d4cexc2 automated match to d4ubpa_ complexed with edo, f, ni, so4 |
PDB Entry: 4cex (more details), 1.59 Å
SCOPe Domain Sequences for d4cexa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cexa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]} mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d4cexa_: