Lineage for d4cexa_ (4cex A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536035Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2536036Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2536037Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2536038Protein Urease, gamma-subunit [54113] (4 species)
  7. 2536039Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries)
  8. 2536042Domain d4cexa_: 4cex A: [259177]
    Other proteins in same PDB: d4cexb_, d4cexc1, d4cexc2
    automated match to d4ubpa_
    complexed with edo, f, ni, so4

Details for d4cexa_

PDB Entry: 4cex (more details), 1.59 Å

PDB Description: 1.59 a resolution fluoride inhibited sporosarcina pasteurii urease
PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d4cexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cexa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d4cexa_:

Click to download the PDB-style file with coordinates for d4cexa_.
(The format of our PDB-style files is described here.)

Timeline for d4cexa_: