Lineage for d4cexb_ (4cex B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817976Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2817977Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2817978Protein Urease, beta-subunit [51280] (4 species)
  7. 2817979Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries)
  8. 2817991Domain d4cexb_: 4cex B: [259181]
    Other proteins in same PDB: d4cexa_, d4cexc1, d4cexc2
    automated match to d4ubpb_
    complexed with edo, f, ni, so4

Details for d4cexb_

PDB Entry: 4cex (more details), 1.59 Å

PDB Description: 1.59 a resolution fluoride inhibited sporosarcina pasteurii urease
PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4cexb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cexb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d4cexb_:

Click to download the PDB-style file with coordinates for d4cexb_.
(The format of our PDB-style files is described here.)

Timeline for d4cexb_: