Lineage for d4ubpc1 (4ubp C:1-131,C:435-483)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428473Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2428474Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2428475Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 2428476Protein alpha-Subunit of urease [51340] (4 species)
  7. 2428477Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries)
  8. 2428478Domain d4ubpc1: 4ubp C:1-131,C:435-483 [28431]
    Other proteins in same PDB: d4ubpa_, d4ubpb_, d4ubpc2
    complexed with hae, ni

Details for d4ubpc1

PDB Entry: 4ubp (more details), 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution
PDB Compounds: (C:) protein (urease (chain c))

SCOPe Domain Sequences for d4ubpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOPe Domain Coordinates for d4ubpc1:

Click to download the PDB-style file with coordinates for d4ubpc1.
(The format of our PDB-style files is described here.)

Timeline for d4ubpc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ubpc2