| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Dengue virus 4 [TaxId:11070] [195988] (5 PDB entries) |
| Domain d4bz1a1: 4bz1 A:301-394 [258889] Other proteins in same PDB: d4bz1a2, d4bz1h1, d4bz1h2, d4bz1l1, d4bz1l2 automated match to d4am0s_ complexed with cl, gol, na, zn |
PDB Entry: 4bz1 (more details), 2.15 Å
SCOPe Domain Sequences for d4bz1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bz1a1 b.1.18.0 (A:301-394) automated matches {Dengue virus 4 [TaxId: 11070]}
mcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfaey
tnsvtnieleppfgdsyivigvgdsaltlhwfrk
Timeline for d4bz1a1:
View in 3DDomains from other chains: (mouse over for more information) d4bz1h1, d4bz1h2, d4bz1l1, d4bz1l2 |