| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4bz1l1: 4bz1 L:1-113 [258893] Other proteins in same PDB: d4bz1a1, d4bz1a2, d4bz1h1, d4bz1h2, d4bz1l2 automated match to d2fd6l1 complexed with cl, gol, na, zn |
PDB Entry: 4bz1 (more details), 2.15 Å
SCOPe Domain Sequences for d4bz1l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bz1l1 b.1.1.0 (L:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsvgekvtlsckssqsllyssnqknhlawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltinsvkaedlavyycqhfyiypytfgggtkleik
Timeline for d4bz1l1:
View in 3DDomains from other chains: (mouse over for more information) d4bz1a1, d4bz1a2, d4bz1h1, d4bz1h2 |