SCOPe 2.08: Domain d4bz1l2: 4bz1 L:114-218

Lineage for d4bz1l2 (4bz1 L:114-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4bz1l2: 4bz1 L:114-218 [258894]
   Other proteins in same PDB: d4bz1a1, d4bz1a2, d4bz1h1, d4bz1h2, d4bz1l1
   automated match to d2fd6l2
   complexed with cl, gol, na, zn

Details for d4bz1l2

PDB Entry: 4bz1, 2.15 Å

PDB Description: Structure of dengue virus EDIII in complex with Fab 3e31

PDB Compounds: (L:) fab 3e31 light chain

SCOPe Domain Sequences for d4bz1l2:

Sequence; same for both SEQRES and ATOM records:

>d4bz1l2 b.1.1.2 (L:114-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfapkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4bz1l2:

• d4bz1l2 first appeared in SCOPe 2.04
  
• d4bz1l2 appears in SCOPe 2.07