Lineage for d4pjgf2 (4pjg F:117-243)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2361942Domain d4pjgf2: 4pjg F:117-243 [258766]
    Other proteins in same PDB: d4pjga1, d4pjga2, d4pjgb1, d4pjgb2, d4pjgc1, d4pjgd_, d4pjge1, d4pjgf1, d4pjgg1, d4pjgh1
    automated match to d3of6b2
    complexed with 30w

Details for d4pjgf2

PDB Entry: 4pjg (more details), 2.4 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-f3-c1 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjgf2 b.1.1.2 (F:117-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

SCOPe Domain Coordinates for d4pjgf2:

Click to download the PDB-style file with coordinates for d4pjgf2.
(The format of our PDB-style files is described here.)

Timeline for d4pjgf2: