SCOPe 2.07: Domain d4pjge1: 4pjg E:2-110

Lineage for d4pjge1 (4pjg E:2-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4pjge1: 4pjg E:2-110 [259936]
   Other proteins in same PDB: d4pjga1, d4pjgb1, d4pjgb2, d4pjgc1, d4pjgd_, d4pjge2, d4pjgf2, d4pjgg2, d4pjgh2
   automated match to d2f54d1
   complexed with 30w

Details for d4pjge1

PDB Entry: 4pjg, 2.4 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-f3-c1 tcr

PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjge1:

Sequence; same for both SEQRES and ATOM records:

>d4pjge1 b.1.1.0 (E:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcasidsnyqliwgagtkliikpd

Timeline for d4pjge1:

• d4pjge1 first appeared in SCOPe 2.04
  
• d4pjge1 appears in SCOPe 2.06
  
• d4pjge1 appears in the current release, SCOPe 2.08