Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (475 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4pjgb1: 4pjg B:1-98 [258168] Other proteins in same PDB: d4pjga1, d4pjga2, d4pjgb2, d4pjgc1, d4pjge1, d4pjge2, d4pjgf1, d4pjgf2, d4pjgg1, d4pjgg2, d4pjgh1, d4pjgh2 automated match to d1k5nb_ complexed with 30w |
PDB Entry: 4pjg (more details), 2.4 Å
SCOPe Domain Sequences for d4pjgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjgb1 b.1.1.2 (B:1-98) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
Timeline for d4pjgb1: