![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (854 PDB entries) |
![]() | Domain d4pjgf2: 4pjg F:117-243 [258766] Other proteins in same PDB: d4pjga1, d4pjga2, d4pjgb1, d4pjgb2, d4pjgc1, d4pjgd_, d4pjge1, d4pjgf1, d4pjgg1, d4pjgh1 automated match to d3of6b2 complexed with 30w |
PDB Entry: 4pjg (more details), 2.4 Å
SCOPe Domain Sequences for d4pjgf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjgf2 b.1.1.2 (F:117-243) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgra
Timeline for d4pjgf2: