Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4pjhb1: 4pjh B:1-98 [258186] Other proteins in same PDB: d4pjha1, d4pjha2, d4pjhb2, d4pjhc1, d4pjhc2, d4pjhd2, d4pjhe1, d4pjhe2, d4pjhf1, d4pjhf2, d4pjhg1, d4pjhg2, d4pjhh1, d4pjhh2 automated match to d1k5nb_ complexed with 30w, gol, na |
PDB Entry: 4pjh (more details), 2 Å
SCOPe Domain Sequences for d4pjhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjhb1 b.1.1.2 (B:1-98) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
Timeline for d4pjhb1: