![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4pjhe2: 4pjh E:111-199 [258191] Other proteins in same PDB: d4pjha1, d4pjha2, d4pjhb1, d4pjhb2, d4pjhc1, d4pjhc2, d4pjhd1, d4pjhd2, d4pjhe1, d4pjhf1, d4pjhg1, d4pjhh1 automated match to d2f54d2 complexed with 30w, gol, na |
PDB Entry: 4pjh (more details), 2 Å
SCOPe Domain Sequences for d4pjhe2:
Sequence, based on SEQRES records: (download)
>d4pjhe2 b.1.1.2 (E:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d4pjhe2 b.1.1.2 (E:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw snkfacanafnnsiipedtffps
Timeline for d4pjhe2: