SCOPe 2.08: Domain d4pjhh1: 4pjh H:3-114

Lineage for d4pjhh1 (4pjh H:3-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4pjhh1: 4pjh H:3-114 [258194]
   Other proteins in same PDB: d4pjha1, d4pjhb1, d4pjhb2, d4pjhc1, d4pjhd1, d4pjhd2, d4pjhe2, d4pjhf2, d4pjhg2, d4pjhh2
   automated match to d3of6c1
   complexed with 30w, gol, na

Details for d4pjhh1

PDB Entry: 4pjh, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-g8 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjhh1:

Sequence; same for both SEQRES and ATOM records:

>d4pjhh1 b.1.1.0 (H:3-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassggdsgelffgegsrltvled

Timeline for d4pjhh1:

• d4pjhh1 first appeared in SCOPe 2.04
  
• d4pjhh1 appears in SCOPe 2.07