SCOPe 2.08: Domain d4pjha1: 4pjh A:1-178

Lineage for d4pjha1 (4pjh A:1-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d4pjha1: 4pjh A:1-178 [263531]
   Other proteins in same PDB: d4pjha2, d4pjhb1, d4pjhb2, d4pjhc2, d4pjhd1, d4pjhd2, d4pjhe1, d4pjhe2, d4pjhf1, d4pjhf2, d4pjhg1, d4pjhg2, d4pjhh1, d4pjhh2
   automated match to d4l4vc1
   complexed with 30w, gol, na

Details for d4pjha1

PDB Entry: 4pjh, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-g8 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjha1:

Sequence, based on SEQRES records:

>d4pjha1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records):

>d4pjha1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwer
ytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfli
fnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4pjha1:

• d4pjha1 first appeared in SCOPe 2.05
  
• d4pjha1 appears in SCOPe 2.07