Lineage for d4pjhc1 (4pjh C:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938700Domain d4pjhc1: 4pjh C:1-178 [263533]
    Other proteins in same PDB: d4pjha2, d4pjhb1, d4pjhb2, d4pjhc2, d4pjhd1, d4pjhd2, d4pjhe1, d4pjhe2, d4pjhf1, d4pjhf2, d4pjhg1, d4pjhg2, d4pjhh1, d4pjhh2
    automated match to d4l4vc1
    complexed with 30w, gol, na

Details for d4pjhc1

PDB Entry: 4pjh (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-g8 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjhc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pjhc1:

Click to download the PDB-style file with coordinates for d4pjhc1.
(The format of our PDB-style files is described here.)

Timeline for d4pjhc1: