SCOPe 2.06: Domain d4ksma2: 4ksm A:76-215

Lineage for d4ksma2 (4ksm A:76-215)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [256898] (2 PDB entries)

8. Domain d4ksma2: 4ksm A:76-215 [256899]
   Other proteins in same PDB: d4ksma1, d4ksma3
   automated match to d3ir4a2
   complexed with trs; mutant

Details for d4ksma2

PDB Entry: 4ksm, 2.4 Å

PDB Description: Crystal structure of Escherichia coli glutraredoxin 2 C9S/C12S mutant without glutathione

PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4ksma2:

Sequence; same for both SEQRES and ATOM records:

>d4ksma2 a.45.1.1 (A:76-215) automated matches {Escherichia coli [TaxId: 83333]}
plltgkrspaieewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

Timeline for d4ksma2:

• d4ksma2 first appeared in SCOPe 2.04
  
• d4ksma2 appears in SCOPe 2.05
  
• d4ksma2 appears in SCOPe 2.07
  
• d4ksma2 appears in the current release, SCOPe 2.08