PDB entry 4ksm

View 4ksm on RCSB PDB site
Description: Crystal structure of Escherichia coli glutraredoxin 2 C9S/C12S mutant without glutathione
Class: electron transport
Keywords: glutaredoxin, glutathione, ELECTRON TRANSPORT
Deposited on 2013-05-17, released 2014-05-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaredoxin-2
    Species: Escherichia coli [TaxId:83333]
    Gene: grxB, b1064, JW1051
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AC59 (1-215)
      • expression tag (0)
      • engineered mutation (9)
      • engineered mutation (12)
    Domains in SCOPe 2.06: d4ksma1, d4ksma2, d4ksma3
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ksmA (A:)
amklyiydhspyslkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrym
pesmdivhyvdkldgkplltgkrspaieewlrkvngyanklllprfaksafdefstpaar
kyfvdkkeasagnfadllahsdgliknisddlraldklivkpnavngelseddiqlfpll
rnltlvaginwpsrvadyrdnmakqtqinllssmai