| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (14 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [256898] (2 PDB entries) |
| Domain d4ksma2: 4ksm A:76-215 [256899] Other proteins in same PDB: d4ksma1, d4ksma3 automated match to d3ir4a2 complexed with trs; mutant |
PDB Entry: 4ksm (more details), 2.4 Å
SCOPe Domain Sequences for d4ksma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ksma2 a.45.1.1 (A:76-215) automated matches {Escherichia coli [TaxId: 83333]}
plltgkrspaieewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai
Timeline for d4ksma2: