SCOPe 2.06: Domain d4ksma1: 4ksm A:1-75

Lineage for d4ksma1 (4ksm A:1-75)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [256896] (3 PDB entries)

8. Domain d4ksma1: 4ksm A:1-75 [256897]
   Other proteins in same PDB: d4ksma2, d4ksma3
   automated match to d3ir4a1
   complexed with trs; mutant

Details for d4ksma1

PDB Entry: 4ksm, 2.4 Å

PDB Description: Crystal structure of Escherichia coli glutraredoxin 2 C9S/C12S mutant without glutathione

PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4ksma1:

Sequence; same for both SEQRES and ATOM records:

>d4ksma1 c.47.1.0 (A:1-75) automated matches {Escherichia coli [TaxId: 83333]}
mklyiydhspyslkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgk

Timeline for d4ksma1:

• d4ksma1 first appeared in SCOPe 2.04
  
• d4ksma1 appears in SCOPe 2.05
  
• d4ksma1 appears in SCOPe 2.07
  
• d4ksma1 appears in the current release, SCOPe 2.08