Lineage for d4ksma1 (4ksm A:1-75)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879467Species Escherichia coli [TaxId:83333] [256896] (3 PDB entries)
  8. 2879470Domain d4ksma1: 4ksm A:1-75 [256897]
    Other proteins in same PDB: d4ksma2, d4ksma3
    automated match to d3ir4a1
    complexed with trs; mutant

Details for d4ksma1

PDB Entry: 4ksm (more details), 2.4 Å

PDB Description: Crystal structure of Escherichia coli glutraredoxin 2 C9S/C12S mutant without glutathione
PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4ksma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ksma1 c.47.1.0 (A:1-75) automated matches {Escherichia coli [TaxId: 83333]}
mklyiydhspyslkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgk

SCOPe Domain Coordinates for d4ksma1:

Click to download the PDB-style file with coordinates for d4ksma1.
(The format of our PDB-style files is described here.)

Timeline for d4ksma1: