![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [256896] (3 PDB entries) |
![]() | Domain d4ksma1: 4ksm A:1-75 [256897] Other proteins in same PDB: d4ksma2, d4ksma3 automated match to d3ir4a1 complexed with trs; mutant |
PDB Entry: 4ksm (more details), 2.4 Å
SCOPe Domain Sequences for d4ksma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ksma1 c.47.1.0 (A:1-75) automated matches {Escherichia coli [TaxId: 83333]} mklyiydhspyslkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp esmdivhyvdkldgk
Timeline for d4ksma1: