SCOP 1.55: Domain d1ds8t1: 1ds8 T:36-256

Lineage for d1ds8t1 (1ds8 T:36-256)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (15 PDB entries)

8. Domain d1ds8t1: 1ds8 T:36-256 [25470]
   Other proteins in same PDB: d1ds8h2, d1ds8l1, d1ds8m1, d1ds8r1, d1ds8s1, d1ds8t2

Details for d1ds8t1

PDB Entry: 1ds8, 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor cd2+

SCOP Domain Sequences for d1ds8t1:

Sequence; same for both SEQRES and ATOM records:

>d1ds8t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1ds8t1:

• d1ds8t1 appears in SCOP 1.57
  
• d1ds8t1 appears in the current release, SCOPe 2.08