Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1ds8t1 (1ds8 T:36-256)

  1. Root: SCOP 1.75B
  2. Class b: All beta proteins [48724] (174 folds)
  3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. Protein Photosynthetic reaction centre [50348] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
    Uniprot P11846
  8. Domain d1ds8t1: 1ds8 T:36-256 [25470]
    Other proteins in same PDB: d1ds8h2, d1ds8l_, d1ds8m_, d1ds8r_, d1ds8s_, d1ds8t2
    complexed with bcl, bph, cd, cl, fe2, lda, u10

Details for d1ds8t1

PDB Entry: 1ds8 (more details)
PDB Description: photosynthetic reaction center from rhodobacter sphaeroides charge-neutral dqaqb state with the proton transfer inhibit
PDB Compounds: (T:) reaction center protein h chain

SCOP Domain Sequences for d1ds8t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds8t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOP Domain Coordinates for d1ds8t1:

Click to download the PDB-style file with coordinates for d1ds8t1.
(The format of our PDB-style files is described here.)

Timeline for d1ds8t1:

d1ds8t1 appears in SCOP 1.75A


d1ds8t1
(click for larger image)


d1ds8t1 in context of chain
Domains from same chain:
d1ds8t2


d1ds8t1 in context of PDB
Domains from other chains:
d1ds8h1, d1ds8h2, d1ds8l_, d1ds8m_, d1ds8r_, d1ds8s_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu