SCOPe 2.08: Domain d4m53a1: 4m53 A:2-206

Lineage for d4m53a1 (4m53 A:2-206)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
   includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)

7. Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries)
   Uniprot Q980A5 2-206

8. Domain d4m53a1: 4m53 A:2-206 [253749]
   Other proteins in same PDB: d4m53a2, d4m53a3
   automated match to d2qn6a3
   protein/RNA complex; complexed with bme, fmt, gcp, mg, na

Details for d4m53a1

PDB Entry: 4m53, 2 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdpcp

PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m53a1:

Sequence; same for both SEQRES and ATOM records:

>d4m53a1 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskklgyaetnigvcesckkpeayvtep
sckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtreh
fvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkinid
sliegieeyiktpy

Timeline for d4m53a1:

• d4m53a1 first appeared in SCOPe 2.04
  
• d4m53a1 appears in SCOPe 2.07